PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27197
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 171aa    MW: 19068 Da    PI: 10.2831
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27197genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.52.5e-53191481128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...kge 98 
               lppGfrFhPtdee+v++yL++k+ ++ +++  vi++vd++k+ePwdLp k+k +ekewyfF+++d+ky+tg+r+nrat++gyWkatgkdke+++    +  
  EMT27197  19 LPPGFRFHPTDEEVVTHYLTPKAVNNAFSC-LVIADVDLNKTEPWDLPGKAKMGEKEWYFFVHKDRKYPTGTRTNRATEKGYWKATGKDKEIFRGkgrDAV 118
               79**************************99.78***************99999****************************************98444444 PP

       NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
               lvg+kktLvfy+grap+g kt  vmheyrl
  EMT27197 119 LVGMKKTLVFYTGRAPRGDKTPYVMHEYRL 148
               5***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-5716153IPR003441NAC domain
PROSITE profilePS5100551.35719171IPR003441NAC domain
PfamPF023656.3E-2820148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MSDVTAAVGL GGGGPRLSLP PGFRFHPTDE EVVTHYLTPK AVNNAFSCLV IADVDLNKTE  60
PWDLPGKAKM GEKEWYFFVH KDRKYPTGTR TNRATEKGYW KATGKDKEIF RGKGRDAVLV  120
GMKKTLVFYT GRAPRGDKTP YVMHEYRLAG QLAPRIPRSA KVMLAPLDGR D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-501614814142NAC domain-containing protein 19
4dul_A4e-501614814142NAC domain-containing protein 19
1ut7_B4e-501614814142NO APICAL MERISTEM PROTEIN
1ut7_A4e-501614814142NO APICAL MERISTEM PROTEIN
1ut4_B4e-501614814142NO APICAL MERISTEM PROTEIN
1ut4_A4e-501614814142NO APICAL MERISTEM PROTEIN
3swp_D4e-501614817145NAC domain-containing protein 19
3swp_C4e-501614817145NAC domain-containing protein 19
3swp_B4e-501614817145NAC domain-containing protein 19
3swp_A4e-501614817145NAC domain-containing protein 19
3swm_D4e-501614817145NAC domain-containing protein 19
3swm_C4e-501614817145NAC domain-containing protein 19
3swm_B4e-501614817145NAC domain-containing protein 19
3swm_A4e-501614817145NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3644980.0AK364498.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2025P03.
GenBankAK3646490.0AK364649.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2027E04.
GenBankAK3670980.0AK367098.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2051F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461233.15e-82hypothetical protein SORBIDRAFT_02g043270
RefseqXP_003559780.14e-82PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9LJW33e-71NAC59_ARATH; NAC domain-containing protein 59
TrEMBLM8CIT61e-124M8CIT6_AEGTA; Protein CUP-SHAPED COTYLEDON 2
STRINGMLOC_65400.11e-104(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29035.13e-68NAC domain containing protein 3